PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 902030 | ||||||||
Common Name | ARALYDRAFT_902030 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 102aa MW: 12380.2 Da PI: 10.8074 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.7 | 1.3e-08 | 35 | 75 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++T++E++l+ + +++ G + W++Ia ++ gR +k++ +w 902030 35 NMTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GREAKDIERYWI 75 68****************99.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.6E-5 | 32 | 80 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.61E-5 | 35 | 74 | No hit | No description |
Pfam | PF00249 | 4.8E-8 | 35 | 75 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.06E-6 | 36 | 75 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.2E-10 | 36 | 75 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MDNTNRLRPL RSPKQTKFTL RYSEEVSSVK WEFTNMTEQE EDLIFRMHRL VGDRWDLIAG 60 RVVGREAKDI ERYWIMRNCD HCSHKRRRRF HKLSRFSISP P* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 76 | 88 | RNCDHCSHKRRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 902030 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP002685 | 6e-54 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
GenBank | FJ972677 | 6e-54 | FJ972677.1 Arabidopsis thaliana ecotype Gr-1 trichomeless2 (TCL2) gene, complete cds. | |||
GenBank | FJ972679 | 6e-54 | FJ972679.1 Arabidopsis thaliana ecotype Oy-0 trichomeless2 (TCL2) gene, complete cds. | |||
GenBank | FJ972680 | 6e-54 | FJ972680.1 Arabidopsis thaliana ecotype Landsberg erecta trichomeless2 (TCL2) gene, complete cds. | |||
GenBank | FJ972681 | 6e-54 | FJ972681.1 Arabidopsis thaliana ecotype Col-0 trichomeless2 (TCL2) gene, complete cds. | |||
GenBank | U93215 | 6e-54 | U93215.3 Arabidopsis thaliana chromosome 2 BAC T6B20 genomic sequence, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002881109.1 | 1e-70 | MYB-like transcription factor TCL2 isoform X1 | ||||
Swissprot | B3H4X8 | 1e-58 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
TrEMBL | D7LC51 | 2e-69 | D7LC51_ARALL; Uncharacterized protein | ||||
STRING | scaffold_401531.1 | 4e-70 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30424.1 | 5e-61 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 902030 |
Entrez Gene | 9317176 |
Publications ? help Back to Top | |||
---|---|---|---|
|