PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 894282 | ||||||||
Common Name | ARALYDRAFT_894282 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 141aa MW: 15904.2 Da PI: 10.39 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49 | 1.4e-15 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd ll +++ ++G g W+ ++ + g++R++k c++rw++yl 894282 10 KGTWTAEEDILLRKCIDKYGEGKWHQVPLRAGLNRCGKGCRLRWLNYL 57 799********************************************7 PP | |||||||
2 | Myb_DNA-binding | 52.5 | 1.2e-16 | 63 | 107 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+++ +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++ 894282 63 RGNFSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 107 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.2E-22 | 3 | 60 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.15 | 5 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.21E-29 | 7 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.6E-12 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-14 | 10 | 57 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.52E-9 | 12 | 57 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 61 | 108 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.173 | 62 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 6.5E-15 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.7E-15 | 63 | 107 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MESSSNGLRK GTWTAEEDIL LRKCIDKYGE GKWHQVPLRA GLNRCGKGCR LRWLNYLQPS 60 IKRGNFSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHFSC CKSKARKRES 120 TCSANSPIQS SCYKASTSIL * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-23 | 8 | 106 | 5 | 102 | B-MYB |
1gv2_A | 1e-23 | 8 | 106 | 2 | 99 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 2e-23 | 8 | 106 | 25 | 122 | MYB TRANSFORMING PROTEIN |
1mse_C | 1e-23 | 8 | 106 | 2 | 99 | C-Myb DNA-Binding Domain |
1msf_C | 1e-23 | 8 | 106 | 2 | 99 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 894282 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF062915 | 9e-94 | AF062915.2 Arabidopsis thaliana putative transcription factor (MYB90) mRNA, MYB90-Col allele, complete cds. | |||
GenBank | AF325124 | 9e-94 | AF325124.1 Arabidopsis thaliana production of anthocyanin pigment 2 protein (PAP2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010513544.1 | 1e-81 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | Q9FNV9 | 6e-66 | MY113_ARATH; Transcription factor MYB113 | ||||
TrEMBL | D7KTP3 | 3e-98 | D7KTP3_ARALL; Uncharacterized protein | ||||
STRING | scaffold_201356.1 | 6e-99 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66380.1 | 5e-66 | myb domain protein 114 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 894282 |
Entrez Gene | 9323098 |
Publications ? help Back to Top | |||
---|---|---|---|
|