PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

856498

Common Name

ARALYDRAFT_655942

Organism

Arabidopsis lyrata

Taxonomic ID

81972

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 102aa MW: 12316.8 Da PI: 10.9269

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
856498	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	21.8	4.5e-07	38	77	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Ia ++ gR ++++ +w 856498 38 MTEQEEDLISRMYRLVGDR-WDLIAGRVV-GRKANEIERFWI 77 79*************99.*****.*******995 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	2.8E-4	34	82	IPR001005	SANT/Myb domain
CDD	cd00167	9.68E-5	37	76	No hit	No description
Pfam	PF00249	1.9E-6	38	77	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.4E-9	39	77	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.59E-6	39	86	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0080147	Biological Process	root hair cell development
GO:1900033	Biological Process	negative regulation of trichome patterning
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MDNTNRLRRG RSFRQTKFTR SRHDSEEVSS IEWEFISMTE QEEDLISRMY RLVGDRWDLI 60 AGRVVGRKAN EIERFWIMRN SDFFSHKRRH FNNSPFFSSP P*

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269\|PubMed:15604688, ECO:0000269\|PubMed:19818620}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	856498

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY234411	1e-105	AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBank	AY519520	1e-105	AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBank	AY649255	1e-105	AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002862821.1	2e-68	MYB-like transcription factor ETC2
Swissprot	Q84RD1	5e-61	ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBL	D7MWK3	4e-67	D7MWK3_ARALL; Predicted protein
STRING	Al_scaffold_0136_3	6e-68	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30420.1	2e-63	MYB_related family protein

Link Out ? help Back to Top
Phytozome	856498
Entrez Gene	9298898

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Huang M,Hu Y,Liu X,Li Y,Hou X Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development. Front Plant Sci, 2015. 6: p. 955 [PMID:26579186] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots. PLoS ONE, 2018. 13(10): p. e0205522 [PMID:30308079]