PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 492289 | ||||||||
Common Name | ARALYDRAFT_492289 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 143aa MW: 16001.3 Da PI: 8.4974 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 39.4 | 1.1e-12 | 4 | 53 | 4 | 55 |
HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 h+e+E++RR+++ s + Lr+ll + ++K s a+ + Av+YI +Lq 492289 4 VHKEVEKQRRQEMASLYTSLRSLLLLEF--IQGKRSTADQVNGAVNYIEYLQ 53 6*************************65..*********************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 11.757 | 1 | 52 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 4.06E-11 | 4 | 66 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 7.5E-10 | 4 | 53 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 7.6E-10 | 4 | 66 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
CDD | cd00083 | 8.94E-9 | 5 | 57 | No hit | No description |
SMART | SM00353 | 2.7E-4 | 6 | 58 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MEKVHKEVEK QRRQEMASLY TSLRSLLLLE FIQGKRSTAD QVNGAVNYIE YLQRNIKDIS 60 SKRDDLVLLS GRSFGSSNEQ DWNQISNHVV IIRPCLVGIE IVFSVLQTPF SSVLKVIREH 120 GLCVLGCISS SVNDKTHSHS TG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 492289 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493699 | 1e-145 | AB493699.1 Arabidopsis thaliana At4g25400 mRNA for hypothetical protein, partial cds, clone: RAAt4g25400. | |||
GenBank | AY142621 | 1e-145 | AY142621.1 Arabidopsis thaliana unknown protein (At4g25400) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020873857.1 | 2e-94 | LOW QUALITY PROTEIN: transcription factor bHLH118 | ||||
Swissprot | Q9STJ7 | 4e-77 | BH118_ARATH; Transcription factor bHLH118 | ||||
TrEMBL | D7MG09 | 3e-99 | D7MG09_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.7__1722__AT4G25400.1 | 1e-100 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4479 | 27 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25400.1 | 2e-71 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 492289 |
Entrez Gene | 9305744 |