PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 482294 | ||||||||
Common Name | ARALYDRAFT_482294 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 259aa MW: 29834.9 Da PI: 10.0055 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.6 | 7.4e-51 | 15 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglk 103 lppGfrFhPtdeelvv+yL++kv+g +l++ +vi+e+d++k++PwdLp e+e yfFs+r+ ky++g+r+nr+t sgyWkatg dk++ + k+ +vg+k 482294 15 LPPGFRFHPTDEELVVQYLRRKVTGLPLPA-SVIPETDVCKSDPWDLPGD---CESERYFFSTREAKYPNGNRSNRSTGSGYWKATGIDKQIGK-KKLVVGMK 112 79****************************.99***************44...46799**********************************99.9999**** PP NAM 104 ktLvfykgrapkgektdWvmheyrl 128 ktLvfykg+ p+g++t+Wv+heyrl 482294 113 KTLVFYKGKPPNGTRTNWVLHEYRL 137 ***********************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.79E-61 | 10 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.83 | 15 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.3E-27 | 16 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 259 aa Download sequence Send to blast |
MEKRSFIKNR GVLRLPPGFR FHPTDEELVV QYLRRKVTGL PLPASVIPET DVCKSDPWDL 60 PGDCESERYF FSTREAKYPN GNRSNRSTGS GYWKATGIDK QIGKKKLVVG MKKTLVFYKG 120 KPPNGTRTNW VLHEYRLVDS QQESSYGQNM NWVLCRVFLK KRSNSTNNKR KEDEKEEIEN 180 EKDKEKDTCP IFYDFMRKDM KKKRRRRRRC CDLNLTPATS TCCCSSSSSA SSSSVCSSAL 240 THTSSNNNHH ENKFCLFL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-54 | 13 | 163 | 15 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_B | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_C | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swm_D | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_A | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_B | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_C | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
3swp_D | 1e-54 | 13 | 163 | 18 | 171 | NAC domain-containing protein 19 |
4dul_A | 1e-54 | 13 | 163 | 15 | 168 | NAC domain-containing protein 19 |
4dul_B | 1e-54 | 13 | 163 | 15 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 200 | 205 | KKKRRR |
2 | 200 | 208 | KKKRRRRRR |
3 | 202 | 207 | KRRRRR |
4 | 202 | 208 | KRRRRRR |
5 | 203 | 208 | RRRRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of the mannan synthase CSLA9. Recognizes and binds to DNA-specific sequence of CSLA9 promoter. {ECO:0000269|PubMed:24243147}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 482294 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF325080 | 0.0 | AF325080.1 Arabidopsis thaliana putative NAM (no apical meristem)-like protein (At2g33480) mRNA, complete cds. | |||
GenBank | AF410299 | 0.0 | AF410299.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. | |||
GenBank | AY093730 | 0.0 | AY093730.1 Arabidopsis thaliana At2g33480/F4P9.25 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010469465.1 | 1e-142 | PREDICTED: NAC domain-containing protein 41-like | ||||
Swissprot | O22798 | 1e-133 | NAC41_ARATH; NAC domain-containing protein 41 | ||||
TrEMBL | D7LGA8 | 0.0 | D7LGA8_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.4__1354__AT2G33480.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1806 | 27 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33480.1 | 1e-113 | NAC domain containing protein 41 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 482294 |
Entrez Gene | 9317352 |
Publications ? help Back to Top | |||
---|---|---|---|
|