PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 476577 | ||||||||
Common Name | ARALYDRAFT_476577 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 255aa MW: 28720.4 Da PI: 6.6742 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.6 | 9.1e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +lv +++++G g W + +++ g+ R++k+c++rw++yl 476577 14 KGEWTAEEDRKLVVYINEHGLGEWGSLPKKAGLQRCGKSCRLRWLNYL 61 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 58.6 | 1.4e-18 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+e +++++++lG++ W++Ia+ m+ Rt++++k++w++ 476577 67 RGKFTPQEEEEIIKYHALLGNR-WAAIAKQMP-SRTDNDIKNHWNSC 111 89********************.*********.***********975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.258 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.75E-29 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.69E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.943 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 7.4E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-17 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.33E-11 | 69 | 109 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.9E-26 | 69 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
MGRTTWFDVD GLRKGEWTAE EDRKLVVYIN EHGLGEWGSL PKKAGLQRCG KSCRLRWLNY 60 LRPGIKRGKF TPQEEEEIIK YHALLGNRWA AIAKQMPSRT DNDIKNHWNS CLKKRLAKKG 120 IDPMTHEPTT TSLTVDVTSS STTSSPTPSP TSSSVSSSSS NGSARFLNKL AAGISSRKHG 180 LESIKTVILS EQPREAVDEE KMMISMEEKE LMSCFMEIDE KLSIDELFCD DSTAGFVAFD 240 DYSLTDPYRY SVYES |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 476577 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF217205 | 0.0 | AF217205.2 Arabidopsis thaliana putative transcription factor (MYB95) mRNA, complete cds. | |||
GenBank | AK118381 | 0.0 | AK118381.1 Arabidopsis thaliana At1g74430 mRNA for putative transcription factor (MYB95), complete cds, clone: RAFL19-64-J20. | |||
GenBank | AY519570 | 0.0 | AY519570.1 Arabidopsis thaliana MYB transcription factor (At1g74430) mRNA, complete cds. | |||
GenBank | BT005272 | 0.0 | BT005272.1 Arabidopsis thaliana At1g74430 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002887540.2 | 0.0 | transcription factor MYB122 | ||||
Swissprot | Q9LE63 | 4e-61 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | D7KS17 | 0.0 | D7KS17_ARALL; Uncharacterized protein (Fragment) | ||||
STRING | fgenesh2_kg.2__1707__AT1G74430.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74430.1 | 1e-135 | myb domain protein 95 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 476577 |
Entrez Gene | 9325039 |