PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 359494 | ||||||||
Common Name | ARALYDRAFT_672259 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 189aa MW: 21094 Da PI: 11.3078 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 103.4 | 2.1e-32 | 50 | 106 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF 359494 50 NEPIFVNAKQYQAILRRRQRRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 106 59****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 3.0E-36 | 48 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.949 | 49 | 109 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 7.6E-27 | 51 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 5.1E-23 | 52 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 54 | 74 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 5.1E-23 | 83 | 106 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
AASWPLHGNV TPHFNGFLSF PYASQHMVQH PQIGGLVPCR VPLPHNIPEN EPIFVNAKQY 60 QAILRRRQRR AKLEAQNKLI KVRKPYLHES RHLHALKRAR GSGGRFLNTK KLQESKSSQA 120 PPFLDPPHVF KNSPGKFRQR DISRGGVGSS GSTTSCSDIT GNNNDMFQQN PQFGFSGYPS 180 NHHVSVLM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-20 | 50 | 126 | 2 | 77 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 64 | 71 | RRRQRRAK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 359494 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493613 | 0.0 | AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002882866.1 | 1e-139 | nuclear transcription factor Y subunit A-6 isoform X1 | ||||
Swissprot | Q9LVJ7 | 1e-117 | NFYA6_ARATH; Nuclear transcription factor Y subunit A-6 | ||||
TrEMBL | D7L2B4 | 1e-137 | D7L2B4_ARALL; Predicted protein | ||||
STRING | Al_scaffold_0003_1456 | 1e-138 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14733 | 16 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G14020.1 | 1e-110 | nuclear factor Y, subunit A6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 359494 |
Entrez Gene | 9318932 |
Publications ? help Back to Top | |||
---|---|---|---|
|