PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 320424 | ||||||||
Common Name | ARALYDRAFT_320424 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 94aa MW: 10989.9 Da PI: 9.7603 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 56.3 | 4e-18 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 rie+ r+ +skR++g++KKAeE+ LCd ev +i++s+t+k 320424 10 RIESLKERSSKYSKRKQGLFKKAEEVALLCDCEVILIVVSPTDK 53 89***************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 21.418 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-25 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-23 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 4.62E-23 | 2 | 84 | No hit | No description |
PRINTS | PR00404 | 2.3E-14 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-17 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.3E-14 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.3E-14 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MGRKKIKLNR IESLKERSSK YSKRKQGLFK KAEEVALLCD CEVILIVVSP TDKPTLFHTR 60 SKSFNKIYDR YCMLSLQERE ERCDLSDLYI IIT* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 320424 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020884452.1 | 8e-52 | agamous-like MADS-box protein AGL66 | ||||
TrEMBL | D7LDF5 | 2e-60 | D7LDF5_ARALL; Uncharacterized protein | ||||
STRING | fgenesh1_pm.C_scaffold_4000481 | 4e-61 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7330 | 18 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26320.1 | 1e-51 | AGAMOUS-like 33 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 320424 |
Entrez Gene | 9315022 |