PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 319991 | ||||||||
Common Name | ARALYDRAFT_319991 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 177aa MW: 20160.9 Da PI: 9.1822 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 93.4 | 4.8e-29 | 6 | 61 | 5 | 60 |
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaas 60 + +C+dCGnqakk+C ++RCRtCCks++f+C+th+kstWvpa++r ++++q +++ 319991 6 GRRCEDCGNQAKKECLYMRCRTCCKSKAFHCQTHIKSTWVPAYRRPHHKHQSQSQP 61 569******************************************99977766543 PP | |||||||
2 | DUF702 | 86 | 8.8e-27 | 60 | 128 | 85 | 154 |
DUF702 85 alsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 + st+ ++ + ++ ++P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGlee 319991 60 QPPSTSNPKR-VQIRTTLGHFPAELSSLADFRCVKVSSIDDGKEQYAYQTTVNIGGHVFRGILHDQGLEE 128 3333333333.344556667***********************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 5.0E-47 | 6 | 127 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 1.5E-28 | 9 | 50 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 4.4E-30 | 78 | 126 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MMMIMGRRCE DCGNQAKKEC LYMRCRTCCK SKAFHCQTHI KSTWVPAYRR PHHKHQSQSQ 60 PPSTSNPKRV QIRTTLGHFP AELSSLADFR CVKVSSIDDG KEQYAYQTTV NIGGHVFRGI 120 LHDQGLEEGM IDHHYNKNSN NHQESLHPST SSCPLMTTSP FTDFMSRAQF SSVLRR* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 319991 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY163777 | 1e-178 | AY163777.1 Arabidopsis thaliana hypothetical protein (F3K23.16) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020885613.1 | 1e-128 | protein SHI RELATED SEQUENCE 3 | ||||
Swissprot | Q9SJT8 | 1e-111 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | D7LBD1 | 1e-131 | D7LBD1_ARALL; Uncharacterized protein | ||||
STRING | fgenesh1_pm.C_scaffold_4000048 | 1e-132 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9188 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21400.1 | 1e-105 | SHI-related sequence3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 319991 |
Entrez Gene | 9314619 |