PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araip.761TD | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 121aa MW: 13676.1 Da PI: 9.7914 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.5 | 2.4e-32 | 62 | 119 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dDgy+WrKYG+K+vk+s++pr+YYrCt gC+vkk+ver++edp++v++tYeg+H+h+ Araip.761TD 62 DDGYRWRKYGKKMVKNSPNPRNYYRCTVDGCRVKKRVERDREDPTYVITTYEGNHTHP 119 8********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.6E-34 | 47 | 119 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.45E-29 | 54 | 120 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.859 | 56 | 121 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.8E-36 | 61 | 120 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-25 | 62 | 119 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MSSDKNKKAA DSPENVGDFG ASGSGSNHLQ GSSNAREVSG SEKKDVRERV AFKTKSEVEI 60 IDDGYRWRKY GKKMVKNSPN PRNYYRCTVD GCRVKKRVER DREDPTYVIT TYEGNHTHPT 120 S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-26 | 51 | 118 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-26 | 51 | 118 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araip.761TD |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016165754.1 | 1e-75 | probable WRKY transcription factor 50 | ||||
Refseq | XP_025667266.1 | 2e-75 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 2e-40 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A445C8Q9 | 1e-60 | A0A445C8Q9_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA17G34210.2 | 1e-52 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 7e-43 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|