PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_6040_a_4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 118aa MW: 13562.8 Da PI: 10.3378 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 52.4 | 1.8e-16 | 68 | 114 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 + pGfrF+Ptd el+++yLkkk+eg+++ + evi+e++i+++ePwdLp Neem_6040_a_4 68 MFPGFRFSPTDVELISYYLKKKIEGSENCV-EVISEIEICRYEPWDLP 114 579************************877.99**************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.23E-17 | 58 | 116 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 18.516 | 68 | 118 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.1E-7 | 70 | 111 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MGARRSKKRL QILSLLSLAK VTKKRRKSNR KDRNRIGATI EEERKSCKLE NMAGVSRETQ 60 MSIAASSMFP GFRFSPTDVE LISYYLKKKI EGSENCVEVI SEIEICRYEP WDLPGSLF |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 6 | 26 | KKRLQILSLLSLAKVTKKRRK |
2 | 22 | 26 | KKRRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006424149.1 | 4e-35 | NAC domain-containing protein 89 | ||||
Refseq | XP_006481513.1 | 3e-35 | NAC domain-containing protein 89 | ||||
Refseq | XP_012078968.1 | 3e-35 | NAC domain-containing protein 89 | ||||
Swissprot | Q9XIN7 | 2e-25 | NAC40_ARATH; NAC domain-containing protein 40 | ||||
TrEMBL | A0A2H5Q9F2 | 2e-34 | A0A2H5Q9F2_CITUN; Uncharacterized protein (Fragment) | ||||
STRING | XP_006481513.1 | 1e-34 | (Citrus sinensis) | ||||
STRING | XP_006424149.1 | 1e-34 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G27300.1 | 1e-27 | NTM1-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|