|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Neem_28516_a_1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
Family |
MYB_related |
Protein Properties |
Length: 122aa MW: 13408.5 Da PI: 9.2894 |
Description |
MYB_related family protein |
Gene Model |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 34.9 | 3.6e-11 | 14 | 49 | 1 | 36 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36
+g+WT+eEd++l+ +++q+G g+W++ +++ ++++
Neem_28516_a_1 14 KGPWTAEEDQKLLAYIEQHGHGSWRALPAKAELTLS 49
79************************9999886665 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |