PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_28263_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 155aa MW: 18207.6 Da PI: 8.3929 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 140.5 | 1e-43 | 6 | 138 | 2 | 127 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk...lelee....vikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 ppGfrF Pt+eelv++yL++k+eg++ + + +i+ v+iy+++PwdLp+ ++ + ++w+fF++r++++a+g r+nr t++gyWka Neem_28263_f_1 6 PPGFRFYPTEEELVSFYLHNKLEGRRqdlN---RlmdrIIPVVNIYDYNPWDLPQfseyLCHRDPEQWFFFIPRQENEARGGRPNRLTTAGYWKA 97 9*************************5552...3333379*************9646653344667***************************** PP NAM 86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127 tg+ v+s +++vg k+t+vfy+grap+g kt+W m+ey+ Neem_28263_f_1 98 TGSPGFVYS-LNRAVGQKRTMVFYRGRAPNGAKTEWKMNEYK 138 *********.8899***************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.98E-46 | 3 | 144 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.839 | 5 | 155 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-23 | 6 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MVEEYPPGFR FYPTEEELVS FYLHNKLEGR RQDLNRLMDR IIPVVNIYDY NPWDLPQFSE 60 YLCHRDPEQW FFFIPRQENE ARGGRPNRLT TAGYWKATGS PGFVYSLNRA VGQKRTMVFY 120 RGRAPNGAKT EWKMNEYKAI EGEASTHSTA AVPMV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-33 | 6 | 149 | 18 | 152 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-33 | 6 | 149 | 18 | 152 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-33 | 6 | 149 | 18 | 152 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-33 | 6 | 149 | 18 | 152 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swm_B | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swm_C | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swm_D | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swp_A | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swp_B | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swp_C | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3swp_D | 8e-33 | 6 | 149 | 21 | 155 | NAC domain-containing protein 19 |
3ulx_A | 8e-33 | 6 | 138 | 16 | 139 | Stress-induced transcription factor NAC1 |
4dul_A | 8e-33 | 6 | 149 | 18 | 152 | NAC domain-containing protein 19 |
4dul_B | 8e-33 | 6 | 149 | 18 | 152 | NAC domain-containing protein 19 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006481732.1 | 3e-90 | NAC domain-containing protein 90-like | ||||
Swissprot | Q9FMR3 | 2e-57 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A2H5MYF9 | 8e-89 | A0A2H5MYF9_CITUN; Uncharacterized protein | ||||
STRING | XP_006481732.1 | 1e-89 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10159 | 10 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 9e-60 | NAC domain containing protein 90 |
Publications ? help Back to Top | |||
---|---|---|---|
|