PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_28239_f_2

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

MYB

Protein Properties

Length: 184aa MW: 20991.8 Da PI: 6.3565

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_28239_f_2	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.9	3.1e-15	19	63	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r+ W++eEde+l+ ++k++G g+W+ ++++ g R++k+c+srw+ Neem_28239_f_2 19 RKLWSKEEDEKLIAYIKEYGEGQWRHVPEKAGIDRCGKSCRSRWL 63 567***************************88********6 PP
2	Myb_DNA-binding	30.5	8.4e-10	74	113	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T+eE +l+ +++ +G++ W Ia+ ++ gRt++++ s+w Neem_28239_f_2 74 DFTAEEAKLISILHTNFGNK-WCEIAKSLP-GRTDEDIGSYW 113 59****************.*****.********* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	20.424	14	70	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-19	17	69	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.95E-24	18	113	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-13	18	68	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-14	19	63	IPR001005	SANT/Myb domain
CDD	cd00167	2.78E-10	22	62	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.3E-13	70	114	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.691	71	123	IPR017930	Myb domain
SMART	SM00717	6.1E-5	71	119	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-7	74	114	IPR001005	SANT/Myb domain
CDD	cd00167	4.14E-6	75	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 184 aa Download sequence Send to blast
MVIKRECSYC KHKTHLTKRK LWSKEEDEKL IAYIKEYGEG QWRHVPEKAG IDRCGKSCRS 60 RWLASLRPNT KCDDFTAEEA KLISILHTNF GNKWCEIAKS LPGRTDEDIG SYWKIKSTIR 120 KLVNSGIEPA SSCNDDDEEE VFYLHGTKNL LGGFLEINER VAQNDLDGEI SAELNLDLTI 180 GPSI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-22	22	125	10	110	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Swissprot	Q9SZP1	2e-37	MYB4_ARATH; Transcription repressor MYB4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	7e-40	myb domain protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]