PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_2547_f_4

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

HSF

Protein Properties

Length: 120aa MW: 13662.6 Da PI: 9.1627

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_2547_f_4	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	87.6	1.6e-27	18	78	2	62
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+y+++ed+++++++sws+ +nsfvv++ ef++++LpkyFkhsnf+SFvRQLn+Y+F Neem_2547_f_4 18 FLSKIYDLVEDSSTNDIVSWSTGNNSFVVWKVAEFSRDLLPKYFKHSNFSSFVRQLNTYEF 78 9***********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	3.4E-28	9	78	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.1E-27	14	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	7.89E-25	16	90	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	5.9E-23	18	79	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.7E-16	18	41	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.7E-16	56	68	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.7E-16	69	81	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 120 aa Download sequence Send to blast
MEAMPSSSAA NGNSLPPFLS KIYDLVEDSS TNDIVSWSTG NNSFVVWKVA EFSRDLLPKY 60 FKHSNFSSFV RQLNTYEFWG NIGQKCRILC AMDTSLSSVS RSIYLAAFKF LKMNVNMMRF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	4e-19	4	78	14	89	Heat shock factor protein 1
5d5v_B	4e-19	4	78	14	89	Heat shock factor protein 1
5d5v_D	4e-19	4	78	14	89	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006443267.2	8e-35	heat stress transcription factor A-1e
Refseq	XP_006478966.1	8e-35	heat stress transcription factor A-1e isoform X1
Refseq	XP_006478968.1	8e-35	heat stress transcription factor A-1e isoform X1
Refseq	XP_024043699.1	8e-35	heat stress transcription factor A-1e
Refseq	XP_024954068.1	5e-35	heat stress transcription factor A-1b isoform X2
Swissprot	Q9SCW5	1e-29	HFA1E_ARATH; Heat stress transcription factor A-1e
TrEMBL	A0A067EBM1	3e-33	A0A067EBM1_CITSI; Uncharacterized protein
STRING	XP_006478966.1	3e-34	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM965	28	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G02990.1	5e-32	heat shock transcription factor A1E

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]