PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_23732_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 136aa MW: 14813.9 Da PI: 4.3445 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 75.8 | 7.4e-24 | 62 | 120 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k++++++d++l+ +isw ++g+sfvv+d+ efa+ +Lp+ Fkh+nf+SFvRQLn+Y Neem_23732_f_1 62 FLSKTFDLVDDRSLDPIISWGSTGESFVVWDPVEFARLILPRNFKHNNFSSFVRQLNTY 120 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 4.2E-25 | 55 | 120 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.22E-23 | 57 | 125 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 3.2E-23 | 58 | 136 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 5.9E-20 | 62 | 120 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-13 | 62 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-13 | 100 | 112 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.0E-13 | 113 | 125 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MENIALPTSP LSPFTELEGF SSFATTPVAE QPPGPPASSS SVMNIVVPHP LESLQGNPVP 60 PFLSKTFDLV DDRSLDPIIS WGSTGESFVV WDPVEFARLI LPRNFKHNNF SSFVRQLNTY 120 VGITVTQPLL AAVICM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 2e-17 | 56 | 120 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 2e-17 | 56 | 120 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006481891.1 | 3e-48 | heat stress transcription factor A-3 isoform X2 | ||||
Swissprot | Q8GYY1 | 2e-38 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
TrEMBL | A0A2P5BVZ0 | 4e-47 | A0A2P5BVZ0_TREOI; Heat shock transcription factor | ||||
STRING | XP_006481889.1 | 4e-47 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM22902 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G03720.1 | 1e-40 | heat shock transcription factor A3 |