PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_23394_f_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18172.8 Da PI: 5.1031 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.9 | 1.5e-31 | 98 | 156 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver++edp++v++tYeg H+h+ Neem_23394_f_2 98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDREDPSYVITTYEGVHTHQ 156 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.0E-34 | 84 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-28 | 91 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.551 | 93 | 158 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.8E-37 | 98 | 157 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.3E-25 | 99 | 156 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MSNSNFLPQD SPESDYAEQT NFELSDYLTF DEWSEEEHAS MIFGSVQNPV YRANEVIEPG 60 ASSSHQEGPS NSDSGSGREK KQVKERVAFK TKSEIEILDD GFKWRKYGKK MVKNSPNPRN 120 YYKCSVDGCP VKKRVERDRE DPSYVITTYE GVHTHQSTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-25 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-25 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 3e-32 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 3e-32 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006474454.1 | 4e-91 | probable WRKY transcription factor 50 isoform X1 | ||||
Refseq | XP_024033930.1 | 2e-91 | probable WRKY transcription factor 50 isoform X1 | ||||
Swissprot | Q8VWQ5 | 4e-48 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A067GDY4 | 2e-95 | A0A067GDY4_CITSI; Uncharacterized protein | ||||
TrEMBL | V4UPS5 | 2e-95 | V4UPS5_9ROSI; Uncharacterized protein | ||||
STRING | XP_006453040.1 | 3e-96 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-50 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|