PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1439_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB_related
Protein Properties Length: 98aa    MW: 11600.6 Da    PI: 10.2588
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1439_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l+ +++++G  +W+  ++  g+ R++k+c++rw +yl
    Neem_1439_f_1 14 KGTWTLEEDRKLIAYIRKYGIWNWTEMPKAAGLLRCGKSCRLRWMNYL 61
                     799*****************99**********99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-22864IPR009057Homeodomain-like
PROSITE profilePS5129421.894965IPR017930Myb domain
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
SuperFamilySSF466895.75E-241590IPR009057Homeodomain-like
CDDcd001673.69E-91661No hitNo description
PfamPF139212.0E-131776No hitNo description
PROSITE profilePS500904.5426298IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.0E-116591IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MVKTGGSEKK FLRKGTWTLE EDRKLIAYIR KYGIWNWTEM PKAAGLLRCG KSCRLRWMNY  60
LRPDIKRGNF SQEEDETIMK LHELLGNRFH QDAAVLII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-191296588B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}.
UniProtTranscriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}.
UniProtINDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467925.18e-50myb-related protein 308-like isoform X1
SwissprotQ7XBH42e-37MYB4_ORYSJ; Transcription factor MYB4
SwissprotQ9LDR83e-37MY102_ARATH; Transcription factor MYB102
TrEMBLA0A067GJW75e-51A0A067GJW7_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006467925.13e-49(Citrus sinensis)
STRINGXP_006449185.15e-50(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-39MYB-like 102
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Park MR, et al.
    Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development.
    Plant Cell Environ., 2010. 33(12): p. 2209-30
    [PMID:20807373]
  3. Soltész A, et al.
    The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants.
    J. Appl. Genet., 2012. 53(2): p. 133-43
    [PMID:22246661]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  6. Zhu L,Guo J,Ma Z,Wang J,Zhou C
    Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis.
    Biomolecules, 2019.
    [PMID:29880735]