PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ahy010748 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 116aa MW: 13444.8 Da PI: 10.8555 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.2 | 1.4e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l++ + G +W+++++ g++R++k+c++rw +yl Ahy010748 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 69 | 111 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ Ahy010748 69 LLTQAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111 5699****************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-22 | 5 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.027 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.18E-28 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.5E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.37E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.774 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-25 | 64 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.3E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-15 | 69 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.90E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL TQAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-29 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014520093.1 | 5e-81 | transcription repressor MYB6 | ||||
Refseq | XP_015964396.1 | 6e-81 | protein ODORANT1 | ||||
Refseq | XP_021768403.1 | 7e-81 | protein ODORANT1-like | ||||
Refseq | XP_025703049.1 | 6e-81 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 1e-78 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A1S3VNX6 | 1e-79 | A0A1S3VNX6_VIGRR; transcription repressor MYB6 | ||||
TrEMBL | A0A445AT64 | 2e-79 | A0A445AT64_ARAHY; Uncharacterized protein | ||||
TrEMBL | A0A445ER21 | 1e-79 | A0A445ER21_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA11G03300.1 | 5e-80 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12350.1 | 8e-80 | myb domain protein 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|