PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_015995-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 85aa MW: 10105.5 Da PI: 11.4366 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.1 | 3.2e-12 | 1 | 46 | 10 | 55 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +NRe+ArrsR RKk +i eL v +L +eN++L+++l++ ++ AHYPO_015995-RA 1 MVSNRESARRSRMRKKRQINELWSQVLQLRNENQELIQTLNHASES 46 579**********************************888876665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57959 | 1.06E-10 | 1 | 45 | No hit | No description |
Pfam | PF00170 | 1.3E-9 | 1 | 46 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 1.33E-9 | 1 | 48 | No hit | No description |
PROSITE profile | PS50217 | 8.841 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 9.5E-10 | 2 | 67 | No hit | No description |
SMART | SM00338 | 0.0038 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MVSNRESARR SRMRKKRQIN ELWSQVLQLR NENQELIQTL NHASESHNKA VQENSMLKQE 60 TSNLRQIMFT YMQHGRLTVL RTHD* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021717866.1 | 3e-32 | basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 8e-21 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0J8C902 | 5e-26 | A0A0J8C902_BETVU; Uncharacterized protein | ||||
STRING | XP_010681298.1 | 8e-27 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 1e-24 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_015995-RA |
Publications ? help Back to Top | |||
---|---|---|---|
|