PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_013833-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 67aa MW: 7330.59 Da PI: 9.9983 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 33.7 | 6.6e-11 | 1 | 38 | 61 | 98 |
E-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 61 ltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 +++GW +F+k+n+L++gD++v++l+++ + ++v+++r AHYPO_013833-RA 1 MSRGWPKFAKDNKLQVGDICVLELMKSCTLLFKVHIIR 38 579**********************9888878888877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.40.330.10 | 8.9E-10 | 1 | 38 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 6.1E-9 | 1 | 38 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.31E-10 | 1 | 39 | IPR015300 | DNA-binding pseudobarrel domain |
PROSITE profile | PS50863 | 10.715 | 1 | 40 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 1.14E-11 | 1 | 38 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
MSRGWPKFAK DNKLQVGDIC VLELMKSCTL LFKVHIIRVR GDAETDAQGV QNMAQAQVKA 60 KAKAQD* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G19184.1 | 3e-07 | B3 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_013833-RA |