PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AHYPO_010412-RA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 20919.5 Da PI: 6.5238 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.5 | 8.2e-20 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++l ++++q+G ++Wkt+a + g++R++k+c++rw++yl AHYPO_010412-RA 18 KGTWTAEEDQKLSNYIQQHGANHWKTVALKAGLNRCGKSCRLRWLNYL 65 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.4 | 5.9e-17 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l AHYPO_010412-RA 71 RGNISDEEEDLIIRLHKLLGNR-WALIAGRLP-GRTDNEIKNYWNSHL 116 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.215 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.97E-30 | 17 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-15 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-17 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.8E-25 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.07E-11 | 20 | 65 | No hit | No description |
PROSITE profile | PS51294 | 26.466 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 2.6E-16 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-15 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-25 | 73 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.51E-11 | 75 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010053 | Biological Process | root epidermal cell differentiation | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MAPKKGEEGL GKRRIVNKGT WTAEEDQKLS NYIQQHGANH WKTVALKAGL NRCGKSCRLR 60 WLNYLRPNIK RGNISDEEED LIIRLHKLLG NRWALIAGRL PGRTDNEIKN YWNSHLSKKV 120 NQEDTKTEFP AVSAAATPSI EEITEEAMEN EDTEIRIDMN EMFDFSAEGT YGLDWVDRSC 180 ASI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-30 | 16 | 120 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00538 | DAP | Transfer from AT5G40330 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010667031.1 | 1e-102 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | Q96276 | 1e-55 | MYB23_ARATH; Transcription factor MYB23 | ||||
TrEMBL | A0A1U8LNS9 | 3e-81 | A0A1U8LNS9_GOSHI; transcription factor WER-like | ||||
TrEMBL | O49017 | 2e-81 | O49017_GOSHI; MYB-like DNA-binding domain protein | ||||
TrEMBL | S4SEV3 | 2e-81 | S4SEV3_GOSTH; MYB2 | ||||
TrEMBL | S4SEV5 | 2e-81 | S4SEV5_GOSHI; MYB2 | ||||
STRING | XP_010667031.1 | 1e-102 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 3e-57 | myb domain protein 23 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AHYPO_010412-RA |
Publications ? help Back to Top | |||
---|---|---|---|
|