PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AHYPO_003054-RA

Organism

Amaranthus hypochondriacus

Taxonomic ID

28502

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus

Family

M-type_MADS

Protein Properties

Length: 66aa MW: 7452.71 Da PI: 10.841

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AHYPO_003054-RA	genome	BYU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.7	4.7e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+ rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+eyss AHYPO_003054-RA 9 KRIENKISRQVTFSKRRSGLLKKAHEISVLCDAQVALIVFSTKGKLFEYSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.5E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.38	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.00E-35	2	63	No hit	No description
SuperFamily	SSF55455	4.84E-30	2	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.4E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MGRGKVELKR IENKISRQVT FSKRRSGLLK KAHEISVLCD AQVALIVFST KGKLFEYSST 60 DSRYF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-22	1	61	1	61	MEF2C
5f28_B	7e-22	1	61	1	61	MEF2C
5f28_C	7e-22	1	61	1	61	MEF2C
5f28_D	7e-22	1	61	1	61	MEF2C
6byy_A	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_B	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_C	8e-22	1	61	1	61	MEF2 CHIMERA
6byy_D	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_A	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_B	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_C	8e-22	1	61	1	61	MEF2 CHIMERA
6bz1_D	8e-22	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021835241.1	2e-35	truncated transcription factor CAULIFLOWER A-like isoform X3
Swissprot	Q6E6S7	2e-32	AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBL	A0A0K9QKC7	3e-34	A0A0K9QKC7_SPIOL; Uncharacterized protein
TrEMBL	A0A0K9QLY8	3e-34	A0A0K9QLY8_SPIOL; Uncharacterized protein
STRING	XP_010666772.1	1e-34	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	2e-34	AGAMOUS-like 8

Link Out ? help Back to Top
Phytozome	AHYPO_003054-RA

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]