PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.9617s0011.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 127aa MW: 14271.6 Da PI: 10.3257 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 36.4 | 9.1e-12 | 2 | 26 | 32 | 56 |
HHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 32 eLAkklgLterqVkvWFqNrRakek 56 LAk+l+L +rqV vWFqNrRa+ k Araha.9617s0011.2.p 2 ALAKQLNLRTRQVEVWFQNRRARTK 26 69*********************98 PP | |||||||
2 | HD-ZIP_I/II | 87.2 | 2.2e-28 | 2 | 61 | 31 | 91 |
HD-ZIP_I/II 31 elareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l Araha.9617s0011.2.p 2 ALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR-AL 61 79*******************************************************9.55 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 12.584 | 1 | 28 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 3.7E-9 | 2 | 26 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 6.42E-10 | 2 | 37 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.4E-10 | 2 | 31 | IPR009057 | Homeodomain-like |
PROSITE pattern | PS00027 | 0 | 3 | 26 | IPR017970 | Homeobox, conserved site |
CDD | cd00086 | 4.03E-7 | 3 | 29 | No hit | No description |
SMART | SM00340 | 1.1E-26 | 28 | 71 | IPR003106 | Leucine zipper, homeobox-associated |
Pfam | PF02183 | 1.4E-11 | 28 | 62 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MALAKQLNLR TRQVEVWFQN RRARTKLKQT EVDCEYLKRC CENLTDENRR LQKEVSELRA 60 LKLSPHLYMH MKPPTTLTMC PSCERVAVTS SSSSVASPVM TSSSPMGPMS PWAAIPLRQR 120 PAAGSH* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 20 | 28 | RRARTKLKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.9617s0011.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ440781 | 0.0 | AJ440781.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT3 (hat3 gene). | |||
GenBank | AY099565 | 0.0 | AY099565.1 Arabidopsis thaliana homeobox-leucine zipper protein HAT3 (At3g60390) mRNA, complete cds. | |||
GenBank | BT008713 | 0.0 | BT008713.1 Arabidopsis thaliana At3g60390 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020882296.1 | 9e-88 | homeobox-leucine zipper protein HAT3 | ||||
Swissprot | P46602 | 3e-77 | HAT3_ARATH; Homeobox-leucine zipper protein HAT3 | ||||
TrEMBL | D7LRP7 | 3e-86 | D7LRP7_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.5__2504__AT3G60390.1 | 5e-87 | (Arabidopsis lyrata) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60390.1 | 2e-67 | homeobox-leucine zipper protein 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.9617s0011.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|