PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G60390.1

Common Name

HAT3, T8B10_50

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 315aa MW: 34747.1 Da PI: 8.3772

Description

homeobox-leucine zipper protein 3

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G60390.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	58.6	1.1e-18	161	215	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++keq +Lee F+++++++ +++ LAk+l+L +rqV vWFqNrRa+ k AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTK 215 788899***********************************************98 PP
2	HD-ZIP_I/II	122.8	1.6e-39	161	250	1	91
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 +kk+rlskeq+ +LEe+F+e+++L+p++K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev+eLr +l AT3G60390.1 161 RKKLRLSKEQALVLEETFKEHSTLNPKQKMALAKQLNLRTRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTDENRRLQKEVSELR-AL 250 69*************************************************************************************9.55 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04618	1.2E-36	1	118	IPR006712	HD-ZIP protein, N-terminal
SuperFamily	SSF46689	5.13E-19	143	218	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	5.2E-19	144	215	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.427	157	217	IPR001356	Homeobox domain
SMART	SM00389	5.1E-15	159	221	IPR001356	Homeobox domain
CDD	cd00086	4.29E-15	161	218	No hit	No description
Pfam	PF00046	4.0E-16	161	215	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	192	215	IPR017970	Homeobox, conserved site
Pfam	PF02183	6.0E-11	217	251	IPR003106	Leucine zipper, homeobox-associated
SMART	SM00340	1.1E-26	217	260	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000021	anatomy	petal primordium
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0004704	anatomy	sepal primordium
PO:0008019	anatomy	leaf lamina base
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 315 aa Download sequence Send to blast
MSERDDGLGL SLSLSLGFNQ KDPSSRLNPM PLASYASSSH MQHMQQSNYN HPQKIQNTWI 60 NMFQSSERNS DMRSFLRGID VNRAPSTVVV DVEDEGAGVS SPNSTVSSVM SGKKSERELM 120 AAAGAVGGGR VEDNEIERAS CSLGGGSDDE DGSGNGDDSS RKKLRLSKEQ ALVLEETFKE 180 HSTLNPKQKM ALAKQLNLRT RQVEVWFQNR RARTKLKQTE VDCEYLKRCC ENLTDENRRL 240 QKEVSELRAL KLSPHLYMHM KPPTTLTMCP SCERVAVTSS SSSVAPPVMN SSSPMGPMSP 300 WAAMPLRQRP AAGSH

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	159	165	SRKKLRL
2	209	217	RRARTKLKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.21112	0.0	flower

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30695191	0.0
Genevisible	251374_at	0.0
Expression Atlas	AT3G60390	-
AtGenExpress	AT3G60390	-
ATTED-II	AT3G60390	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes homeobox protein HAT3.
UniProt	Probable transcription factor. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. [PMID: 22918502] The authors show that leaf orientation, morphology and position are pre-patterned by HAT3 and KAN gene expression in the shoot, leading to a model in which dorsoventral genes coordinate to regulate plant development by localizing auxin response between their expression domains. [PMID: 28895530]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G60390.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G16780, AT4G37790, AT5G06710, AT5G47370
IntAct	Search P46602

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G60390

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ440781	0.0	AJ440781.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT3 (hat3 gene).
GenBank	AY099565	0.0	AY099565.1 Arabidopsis thaliana homeobox-leucine zipper protein HAT3 (At3g60390) mRNA, complete cds.
GenBank	BT008713	0.0	BT008713.1 Arabidopsis thaliana At3g60390 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191598.1	0.0	homeobox-leucine zipper protein 3
Swissprot	P46602	0.0	HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBL	A0A178V9W8	0.0	A0A178V9W8_ARATH; HAT3
STRING	AT3G60390.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2577	27	72
Representative plant	OGRP196	16	156

Link Out ? help Back to Top
Phytozome	AT3G60390.1
Entrez Gene	825210
iHOP	AT3G60390
wikigenes	AT3G60390

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Jiao Y, et al. A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] DeCook R,Lall S,Nettleton D,Howell SH Genetic regulation of gene expression during shoot development in Arabidopsis. Genetics, 2006. 172(2): p. 1155-64 [PMID:15956669] Nakayama N, et al. Gene trap lines define domains of gene regulation in Arabidopsis petals and stamens. Plant Cell, 2005. 17(9): p. 2486-506 [PMID:16055634] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Tan QK,Irish VF The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development. Plant Physiol., 2006. 140(3): p. 1095-108 [PMID:16428600] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] Heyl A, et al. The transcriptional repressor ARR1-SRDX suppresses pleiotropic cytokinin activities in Arabidopsis. Plant Physiol., 2008. 147(3): p. 1380-95 [PMID:18502977] Ciarbelli AR, et al. The Arabidopsis homeodomain-leucine zipper II gene family: diversity and redundancy. Plant Mol. Biol., 2008. 68(4-5): p. 465-78 [PMID:18758690] Sorin C,Salla-Martret M,Bou-Torrent J,Roig-Villanova I,Martínez-García JF ATHB4, a regulator of shade avoidance, modulates hormone response in Arabidopsis seedlings. Plant J., 2009. 59(2): p. 266-77 [PMID:19392702] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Bou-Torrent J, et al. ATHB4 and HAT3, two class II HD-ZIP transcription factors, control leaf development in Arabidopsis. Plant Signal Behav, 2012. 7(11): p. 1382-7 [PMID:22918502] Turchi L, et al. Arabidopsis HD-Zip II transcription factors control apical embryo development and meristem function. Development, 2013. 140(10): p. 2118-29 [PMID:23578926] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zou LJ, et al. Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus. Plant Cell Physiol., 2016. 57(9): p. 1879-89 [PMID:27328697] Caggiano MP, et al. Cell type boundaries organize plant development. Elife, 2018. [PMID:28895530] Schena M,Davis RW Structure of homeobox-leucine zipper genes suggests a model for the evolution of gene families. Proc. Natl. Acad. Sci. U.S.A., 1994. 91(18): p. 8393-7 [PMID:7915839]