PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.4512s0002.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 184aa MW: 20889.4 Da PI: 9.845 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 106.4 | 1.4e-33 | 43 | 100 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+ Araha.4512s0002.1.p 43 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSEDPSIVITTYEGQHCHQ 100 8********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.1E-34 | 27 | 101 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.24E-29 | 34 | 100 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.838 | 37 | 102 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.6E-39 | 42 | 101 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-26 | 43 | 100 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
NSTASAEKTP PLETPAKEKK KAQKRIRQPR FAFMTKSDVD NLEDGYRWRK YGQKAVKNSP 60 FPRSYYRCTN SRCTVKKRVE RSSEDPSIVI TTYEGQHCHQ TIGFPRGGIL TAHDPHSFTS 120 HHHLPPPLPN PYYYQELLHQ LHRDNNSPSP RLPQSTTEDA PSVSKPSEEG LLGDIVPQTM 180 RNP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 32 | 99 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 32 | 99 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00067 | PBM | Transfer from AT1G69310 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.4512s0002.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY071849 | 0.0 | AY071849.1 Arabidopsis thaliana WRKY transcription factor 57 (WRKY57) mRNA, complete cds. | |||
GenBank | BT026057 | 0.0 | BT026057.1 Arabidopsis thaliana At1g69310 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010470908.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Refseq | XP_010470909.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Refseq | XP_010470911.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Refseq | XP_010470912.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Refseq | XP_019093150.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Refseq | XP_019093151.1 | 1e-127 | PREDICTED: probable WRKY transcription factor 57 | ||||
Swissprot | Q9C983 | 1e-114 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
TrEMBL | D7KX02 | 1e-112 | D7KX02_ARALL; Uncharacterized protein | ||||
STRING | XP_010470908.1 | 1e-126 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4995 | 27 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 1e-118 | WRKY DNA-binding protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.4512s0002.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|