PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.2135s0003.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 174aa MW: 19536 Da PI: 10.1744 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.1 | 5.6e-15 | 27 | 71 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + k++G+g+W+ I+r + +Rt+ q+ s+ qky Araha.2135s0003.1.p 27 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 71 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.772 | 20 | 76 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.66E-17 | 22 | 75 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.4E-18 | 23 | 75 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 4.8E-13 | 24 | 71 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.2E-13 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-13 | 27 | 71 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.85E-12 | 27 | 72 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MKYHLIVCNK RSPAGRSPEL ERKKGVPWTE EEHKLFLMGL KKYGKGDWRN ISRNFVITRT 60 PTQVASHAQK YFIRQLSGGK DKRRASIHDI TTVNLEDEAS LETNKSSIVV GEQRSRLTAF 120 PWNPTDNNGT HANAFNIRIG NAINGVHSYG QVLLGGFNNA DSCYDAQNTM FQL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00568 | DAP | Transfer from AT5G58900 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.2135s0003.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK118891 | 0.0 | AK118891.1 Arabidopsis thaliana At5g58900 mRNA for putative I-box binding factor, complete cds, clone: RAFL21-22-M07. | |||
GenBank | AY519533 | 0.0 | AY519533.1 Arabidopsis thaliana MYB transcription factor (At5g58900) mRNA, complete cds. | |||
GenBank | BT005473 | 0.0 | BT005473.1 Arabidopsis thaliana clone U51211 putative I-box binding factor (At5g58900) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020869590.1 | 1e-119 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 4e-55 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | D7MR44 | 1e-117 | D7MR44_ARALL; Myb family transcription factor | ||||
STRING | fgenesh2_kg.8__1829__AT5G58900.1 | 1e-118 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1228 | 27 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 1e-117 | Homeodomain-like transcriptional regulator |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.2135s0003.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|