PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Araha.20436s0006.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 229aa MW: 24552.1 Da PI: 10.6365 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.7 | 6.4e-14 | 135 | 179 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + ++lG+g+W+ I+r + Rt+ q+ s+ qky Araha.20436s0006.1.p 135 PWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKY 179 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.581 | 128 | 184 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.37E-17 | 130 | 184 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.1E-18 | 131 | 182 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.7E-10 | 132 | 182 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-11 | 134 | 178 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.13E-10 | 135 | 180 | No hit | No description |
Pfam | PF00249 | 2.2E-11 | 135 | 179 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MTRRCSHCSN NGHNSRTCPT RGGGTCGGSG GGGGGGGSCS SSAVKLFGVR LTDGSIIKKS 60 ASMGNLSALA VAAAAATHHR LSPSSPLATS NLNDSPLSDH ARYSNLHHNE GYLSDDPAHG 120 SGSSHRRGER KRGVPWTEEE HRLFLVGLQK LGKGDWRGIS RNYVTSRTPT QVASHAQKYF 180 IRHTSSSRRK RRSSLFDMVT DEMVTDSSPT QEDQSHQTLN HFSPKIRQ* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Araha.20436s0006.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT005832 | 0.0 | BT005832.1 Arabidopsis thaliana At3g16350 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020889168.1 | 1e-122 | transcription factor MYBS3 | ||||
Swissprot | Q7XC57 | 3e-68 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
TrEMBL | D7L5N9 | 1e-120 | D7L5N9_ARALL; Uncharacterized protein | ||||
TrEMBL | O04322 | 1e-120 | O04322_ARATH; Myb-related transcription activator (MybSt1) isolog | ||||
STRING | fgenesh2_kg.3__1788__AT3G16350.1 | 1e-121 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9313 | 27 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16350.1 | 1e-119 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Araha.20436s0006.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|