PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.17849s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 150aa    MW: 17872.5 Da    PI: 10.5033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.17849s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-15453148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                          r+rW+ eEd ll  +v+q+G++ W++++++m+  ++R +k+c +rw +yl
  Araha.17849s0001.1.p  4 RQRWSGEEDALLRAYVRQFGPREWHLVSERMNkpLNRDAKSCLERWKNYL 53
                          89**********************************************97 PP

2Myb_DNA-binding38.43e-1259103147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Araha.17849s0001.1.p  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                           6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.469153IPR017930Myb domain
SMARTSM007171.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.33E-22498IPR009057Homeodomain-like
CDDcd001679.11E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.6E-20660IPR009057Homeodomain-like
PfamPF139217.0E-14767No hitNo description
PROSITE profilePS5129423.24854108IPR017930Myb domain
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-1661102IPR009057Homeodomain-like
CDDcd001677.82E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SERMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP  120
IDESKYDRIL ESFAEKLVKE RSNVVPAAAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-167100797MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-167100797C-Myb DNA-Binding Domain
1msf_C1e-167100797C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for normal cell differentiation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 2 (LBD6/AS2) to repress the knox homeobox genes BP/KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3/ETT, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11076771, PubMed:11140682, PubMed:11882937, PubMed:12750468, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509, PubMed:23271976). Binds directly to KNAT1, KNAT2, and KNATM chromatin, regulating leaf development (PubMed:23271976). LBD6 is required for this binding (PubMed:23271976). Positive regulator of flowering that binds to the promoter of FT (PubMed:21950734). Regulates FT expression by forming a functional complex with CO (PubMed:21950734). Involved in leaf polarity establishment by functioning cooperatively with NUCL1 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11076771, ECO:0000269|PubMed:11140682, ECO:0000269|PubMed:11882937, ECO:0000269|PubMed:12750468, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAraha.17849s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation with an afternoon peak in long days and with a broad night peak in short days (PubMed:21950734). Expression of AS1 in stem cells of the shoot apical meristem is prevented by SHOOT MERISTEMLESS (STM). Expression is activated by GTE6 during leaf morphogenesis (PubMed:16166385). {ECO:0000269|PubMed:16166385, ECO:0000269|PubMed:21950734}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0046840.0AC004684.3 Arabidopsis thaliana chromosome 2 clone F13M22 map ve018, complete sequence.
GenBankAF1759960.0AF175996.1 Arabidopsis thaliana putative transcription factor (MYB91) mRNA, complete cds.
GenBankAY5195780.0AY519578.1 Arabidopsis thaliana MYB transcription factor (At2g37630) mRNA, complete cds.
GenBankBT0260270.0BT026027.1 Arabidopsis thaliana At2g37630 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881519.11e-102transcription factor AS1
RefseqXP_002881522.11e-102transcription factor AS1
SwissprotO809311e-103AS1_ARATH; Transcription factor AS1
TrEMBLD7LJV51e-101D7LJV5_ARALL; Uncharacterized protein
TrEMBLD7LJW11e-101D7LJW1_ARALL; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40015201e-102(Arabidopsis lyrata)
STRINGscaffold_402408.11e-102(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-106MYB family protein
Publications ? help Back to Top
  1. Hazen SP, et al.
    Rapid array mapping of circadian clock and developmental mutations in Arabidopsis.
    Plant Physiol., 2005. 138(2): p. 990-7
    [PMID:15908595]
  2. Pinon V, et al.
    Three PIGGYBACK genes that specifically influence leaf patterning encode ribosomal proteins.
    Development, 2008. 135(7): p. 1315-24
    [PMID:18305008]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Zhou F,Roy B,Dunlap JR,Enganti R,von Arnim AG
    Translational control of Arabidopsis meristem stability and organogenesis by the eukaryotic translation factor eIF3h.
    PLoS ONE, 2014. 9(4): p. e95396
    [PMID:24736281]
  5. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  6. Ivanova A, et al.
    A Functional Antagonistic Relationship between Auxin and Mitochondrial Retrograde Signaling Regulates Alternative Oxidase1a Expression in Arabidopsis.
    Plant Physiol., 2014. 165(3): p. 1233-1254
    [PMID:24820025]
  7. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  8. Kaurilind E,Xu E,Brosché M
    A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
    BMC Genomics, 2015. 16: p. 837
    [PMID:26493993]
  9. Mateo-Bonmatí E, et al.
    Plastid control of abaxial-adaxial patterning.
    Sci Rep, 2015. 5: p. 15975
    [PMID:26522839]
  10. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  11. Guzmán-López JA,Abraham-Juárez MJ,Lozano-Sotomayor P,de Folter S,Simpson J
    Arabidopsis thaliana gonidialess A/Zuotin related factors (GlsA/ZRF) are essential for maintenance of meristem integrity.
    Plant Mol. Biol., 2016. 91(1-2): p. 37-51
    [PMID:26826012]
  12. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  13. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  14. Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ
    Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development.
    G3 (Bethesda), 2018. 8(4): p. 1379-1390
    [PMID:29487187]
  15. Tsukaya H,Uchimiya H
    Genetic analyses of the formation of the serrated margin of leaf blades in Arabidopsis: combination of a mutational analysis of leaf morphogenesis with the characterization of a specific marker gene expressed in hydathodes and stipules.
    Mol. Gen. Genet., 1997. 256(3): p. 231-8
    [PMID:9393447]