PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.TY4I3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 200aa MW: 22727.1 Da PI: 9.4922 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 82.5 | 2.6e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n rqvtfskRr g+lKKA+ELSvLCdae a+i+fs tgkl+ y+s Aradu.TY4I3 9 KKIDNVAARQVTFSKRRRGLLKKAHELSVLCDAELALIVFSATGKLFHYAS 59 689*********************************************986 PP | |||||||
2 | K-box | 34.7 | 7.4e-13 | 89 | 164 | 19 | 99 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +++akL +e+ + +e+R++ GedLe L+l+ Lq+Le+ Le++l +++ ++ +i +lq+k l+eenk+L++k++ Aradu.TY4I3 89 EDSAKLCEEVAKRTQELRRMDGEDLEGLDLRGLQNLEKTLETGLD-----REKRIMGEILQLQNKGITLEEENKQLKQKVA 164 56899999999999******************************8.....4677999*********************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.128 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.6E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-29 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.36E-38 | 3 | 73 | No hit | No description |
Pfam | PF00319 | 8.7E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.922 | 84 | 169 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 8.2E-10 | 90 | 163 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MTRTKIKIKK IDNVAARQVT FSKRRRGLLK KAHELSVLCD AELALIVFSA TGKLFHYASS 60 SLDDTIKRYN NGHFHDINKL ERLPNLQIED SAKLCEEVAK RTQELRRMDG EDLEGLDLRG 120 LQNLEKTLET GLDREKRIMG EILQLQNKGI TLEEENKQLK QKVAVLRKGK NNPPFLCSSN 180 LPPEDDSSDT SLKLGLPFSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 8e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 8e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 8e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 8e-21 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.TY4I3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025613216.1 | 1e-134 | MADS-box protein AGL24 | ||||
Swissprot | Q9FVC1 | 7e-56 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A445C9F1 | 1e-132 | A0A445C9F1_ARAHY; Uncharacterized protein | ||||
STRING | XP_004490446.1 | 6e-71 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF890 | 33 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 8e-51 | MIKC_MADS family protein |