PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.Q3VNF | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 131aa MW: 14990.2 Da PI: 6.7852 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 62.1 | 9e-20 | 29 | 96 | 29 | 99 |
-..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 + + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F + +++el+++++r+ Aradu.Q3VNF 29 Q-RPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGELRLGIRRA 96 3.34679************************************************..3489999****996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 11.42 | 1 | 97 | IPR003340 | B3 DNA binding domain |
SMART | SM01019 | 4.6E-6 | 6 | 97 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 3.4E-23 | 24 | 101 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 5.1E-25 | 24 | 98 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.6E-17 | 26 | 96 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 1.91E-14 | 30 | 95 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MCLLLNEAPL LVDADGEEDD TEAVDYSQQR PSQELVAKDL HGLEWRFRHI YRGQPRRHLL 60 TTGWSAFVNK KKLVSGDAVL FLRGDDGELR LGIRRAAQLK NGLTTLLLRD SFLSSFLMAS 120 VQFMLCIKQE W |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldy_A | 3e-32 | 18 | 121 | 147 | 250 | Auxin response factor 1 |
4ldy_B | 3e-32 | 18 | 121 | 147 | 250 | Auxin response factor 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.Q3VNF |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025682337.1 | 2e-52 | auxin response factor 3 | ||||
Swissprot | Q8S985 | 9e-47 | ARFO_ORYSJ; Auxin response factor 15 | ||||
TrEMBL | A0A444WYR3 | 4e-51 | A0A444WYR3_ARAHY; Auxin response factor | ||||
STRING | EOY28143 | 8e-48 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15884 | 6 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33860.1 | 2e-45 | ARF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|