PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Aradu.5W0HK

Organism

Arachis duranensis

Taxonomic ID

130453

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis

Family

MYB_related

Protein Properties

Length: 145aa MW: 17071.9 Da PI: 10.908

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Aradu.5W0HK	genome	NCGR_PGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	41.1	4e-13	84	121	8	47
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 E++ +d+++ql ++ W+ I ++++ gRt++++k++w+++ Aradu.5W0HK 84 EEKMVIDLHAQLRNR-WSMITSHLP-GRTDNEIKNHWNTH 121 8999*********.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.6E-6	34	60	IPR009057	Homeodomain-like
SuperFamily	SSF46689	4.62E-13	37	118	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-10	39	124	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-18	70	127	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.707	72	126	IPR017930	Myb domain
Pfam	PF00249	3.8E-10	84	121	IPR001005	SANT/Myb domain
CDD	cd00167	1.50E-8	84	122	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 145 aa Download sequence Send to blast
RKQSVERNRE DKDSKFRLIS LITSLRFRFS PTTLSVGLKK GPWTAEEDKK LINFILNNGQ 60 CVVKVALVDN LRPYVKRGLL LKYEEKMVID LHAQLRNRWS MITSHLPGRT DNEIKNHWNT 120 HIKKKLKKLR IDPVTYKPFS NNTTD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-16	38	126	5	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269\|PubMed:23660402}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Aradu.5W0HK

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269\|PubMed:23660402}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001234300.2	3e-52	myb-related transcription factor
Refseq	XP_006364618.1	4e-52	PREDICTED: protein ODORANT1
Refseq	XP_015057255.1	4e-52	transcription factor MYB20
Swissprot	Q9C7U7	7e-50	MYB20_ARATH; Transcription factor MYB20
TrEMBL	A0A3Q7JJ36	6e-51	A0A3Q7JJ36_SOLLC; Uncharacterized protein
TrEMBL	M1B9Y8	8e-51	M1B9Y8_SOLTU; Uncharacterized protein
TrEMBL	Q40173	3e-51	Q40173_SOLLC; Myb-related transcription factor
STRING	Solyc11g011050.1.1	1e-51	(Solanum lycopersicum)
STRING	PGSC0003DMT400040462	1e-51	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66230.1	3e-52	myb domain protein 20

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]