PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.583N0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 67aa MW: 7268.48 Da PI: 10.746 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.1 | 2.4e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev v ifsstgkly+y+s Aradu.583N0 10 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGVAIFSSTGKLYDYAS 59 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 4.0E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.062 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.51E-37 | 2 | 66 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-28 | 2 | 64 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELSILCD AEVGVAIFSS TGKLYDYASS 60 SAKCVVA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 4e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 4e-20 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 4e-20 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.583N0 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 1e-51 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020962192.1 | 1e-35 | MADS-box transcription factor 27 isoform X7 | ||||
Refseq | XP_020984555.1 | 1e-35 | agamous-like MADS-box protein AGL16 isoform X7 | ||||
Refseq | XP_021659610.1 | 1e-35 | MADS-box transcription factor ANR1-like isoform X4 | ||||
Refseq | XP_025668876.1 | 1e-35 | MADS-box transcription factor 27 isoform X7 | ||||
Swissprot | Q9SI38 | 2e-32 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
TrEMBL | A0A2C9VIG1 | 8e-35 | A0A2C9VIG1_MANES; Uncharacterized protein (Fragment) | ||||
TrEMBL | A0A2I0KYR4 | 4e-34 | A0A2I0KYR4_PUNGR; Uncharacterized protein | ||||
TrEMBL | V4NWA2 | 4e-35 | V4NWA2_EUTSA; Uncharacterized protein | ||||
STRING | XP_006409663.1 | 7e-36 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G14210.1 | 8e-35 | AGAMOUS-like 44 |
Publications ? help Back to Top | |||
---|---|---|---|
|