PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aradu.08TAH | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 229aa MW: 26662 Da PI: 5.7905 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 121.3 | 8.6e-38 | 52 | 171 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF Ptdeelvv++L++k++ +++ +vi+++d+y ++Pw+L+ ++ ae ++wy++s+r + +r+t++gyWkatg +++v+++ ++ Aradu.08TAH 52 LPPGFRFYPTDEELVVHFLHRKAALLPCHP-DVIPDLDLYPYDPWELDGRALAEGNQWYYYSRRTQ--------SRVTENGYWKATGMEEPVMTSsTN 140 79*************************999.99**************977778899******9854........799****************98677 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + vg+kk +vf+ g++p++ kt+W+m+ey l Aradu.08TAH 141 KRVGIKKYFVFHLGESPSAIKTNWIMQEYCL 171 88***************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-48 | 47 | 198 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.495 | 52 | 199 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.1E-22 | 53 | 171 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
AWVSRQHPYY KYLSFSICTI NTTHLHHYSN LTHSLLLFSL LIFLMGDNNV NLPPGFRFYP 60 TDEELVVHFL HRKAALLPCH PDVIPDLDLY PYDPWELDGR ALAEGNQWYY YSRRTQSRVT 120 ENGYWKATGM EEPVMTSSTN KRVGIKKYFV FHLGESPSAI KTNWIMQEYC LSDYSASSSR 180 SSKRKSDYSK WVICRVYERN GDDDDGTELS CLDEVFLSLD DLDEISLPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-40 | 48 | 200 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-40 | 48 | 200 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-40 | 48 | 200 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-40 | 48 | 200 | 13 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swm_B | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swm_C | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swm_D | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swp_A | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swp_B | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swp_C | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
3swp_D | 5e-40 | 48 | 200 | 16 | 169 | NAC domain-containing protein 19 |
4dul_A | 4e-40 | 48 | 200 | 13 | 166 | NAC domain-containing protein 19 |
4dul_B | 4e-40 | 48 | 200 | 13 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Aradu.08TAH |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015943391.1 | 1e-137 | NAC domain-containing protein 104 | ||||
Refseq | XP_025622374.1 | 1e-137 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 6e-90 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A445BAD7 | 1e-136 | A0A445BAD7_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA08G19300.1 | 1e-109 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1736 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 3e-86 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|