PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe7G386400.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 136aa MW: 15368.3 Da PI: 9.2313 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 131.5 | 1.1e-40 | 20 | 108 | 82 | 170 |
YABBY 82 lksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 l+ +++ ++ sts + +k+s ++ + + rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+i fgl Aqcoe7G386400.3.p 20 LQDHKIDHQLGSTSSKCNKISMLSSATNNEERIIHRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIQFGL 108 34444444444444444444444444444444578****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.1E-40 | 11 | 108 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 4.97E-9 | 44 | 102 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 7.2E-5 | 56 | 102 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
GO:1902183 | Biological Process | regulation of shoot apical meristem development | ||||
GO:2000024 | Biological Process | regulation of leaf development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MAAALQSLSW QDLQTQSFPL QDHKIDHQLG STSSKCNKIS MLSSATNNEE RIIHRPPEKR 60 QRVPSAYNQF IKEEIQRIKA NNPDISHREA FSTAAKNWAH FPHIQFGLML EANNQAKMNE 120 GAEKHLMTTA ALFNN* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010254434.1 | 3e-68 | PREDICTED: axial regulator YABBY 5-like | ||||
Swissprot | Q8GW46 | 4e-49 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
TrEMBL | A0A2G5DG19 | 1e-95 | A0A2G5DG19_AQUCA; Uncharacterized protein | ||||
TrEMBL | A0A2G5DGR6 | 6e-96 | A0A2G5DGR6_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_020_00105.1 | 2e-96 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 1e-51 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe7G386400.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|