PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe6G153100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 226aa MW: 25436.8 Da PI: 5.4728 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 91.4 | 4.4e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n++ rqvtfskRr g+lKKA+ELS+LCdaeva+iifs tgkl+eyss Aqcoe6G153100.1.p 9 KKIDNTTARQVTFSKRRRGLLKKAHELSILCDAEVALIIFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 49.9 | 1.4e-17 | 80 | 170 | 8 | 98 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 ++ + + + ++++a+L kei + +++R++ Ge+L +L+++eLqqLe+ Le++l+++ ++K++ ++++i++l k l een++Lrk++ Aqcoe6G153100.1.p 80 DQPSLELQLENNNYARLSKEIAEKSHQLRQMRGEELRELNIEELQQLEKSLETGLSRVLETKSDKIMKEISTLHTKGMLLMEENERLRKQV 170 456667788899*****************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.529 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.89E-31 | 3 | 84 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.61E-39 | 3 | 68 | No hit | No description |
PRINTS | PR00404 | 9.6E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 9.6E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.501 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.9E-16 | 90 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MVREKIQIKK IDNTTARQVT FSKRRRGLLK KAHELSILCD AEVALIIFSA TGKLFEYSSS 60 SMGEILERQS LHSKNLQKLD QPSLELQLEN NNYARLSKEI AEKSHQLRQM RGEELRELNI 120 EELQQLEKSL ETGLSRVLET KSDKIMKEIS TLHTKGMLLM EENERLRKQV VDMSSEQGNV 180 PGDLENNVVF EEGQSSESVT NISNPGGPPP DNDSSDTSLR LGLSL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_B | 1e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_C | 1e-21 | 1 | 66 | 1 | 66 | MEF2C |
5f28_D | 1e-21 | 1 | 66 | 1 | 66 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ173339 | 0.0 | HQ173339.1 Aquilegia formosa AGAMOUS-like 24-like protein 2 (AGL24.2) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010254525.1 | 1e-121 | PREDICTED: MADS-box protein SVP isoform X2 | ||||
Swissprot | Q9FUY6 | 1e-107 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | F2WNM8 | 1e-148 | F2WNM8_AQUFO; AGAMOUS-like 24-like protein 2 (Fragment) | ||||
STRING | Aquca_015_00177.1 | 1e-135 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-101 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe6G153100.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|