PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe5G160100.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 182aa MW: 20891 Da PI: 9.5067 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.5 | 8.5e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n++ rqvtfskRr g++KKAeELS+LCda+va+iifs tgkl+eyss Aqcoe5G160100.3.p 9 KKIDNTTARQVTFSKRRRGLFKKAEELSILCDADVALIIFSATGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 58.7 | 2.4e-20 | 85 | 170 | 13 | 98 |
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + + + ++a+L ke+ + r++R++ Ge+L+ L+++eLqqLe+ Le++l+++ ++K++ ++++i++lq k +l een++L++kl Aqcoe5G160100.3.p 85 ELQLENGNYARLSKEVAERSRQLRNMRGEELQGLNIEELQQLEKSLETGLSRVLETKSDWIMNEISTLQAKGAKLMEENERLKQKL 170 556667789***************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.221 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.8E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.64E-40 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-31 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.014 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.2E-17 | 91 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MAREKIQIKK IDNTTARQVT FSKRRRGLFK KAEELSILCD ADVALIIFSA TGKLFEYSSS 60 SMKEILERHN LHSKNLHKLD QPSLELQLEN GNYARLSKEV AERSRQLRNM RGEELQGLNI 120 EELQQLEKSL ETGLSRVLET KSDWIMNEIS TLQAKGAKLM EENERLKQKL VKFLCADGRD 180 I* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ173338 | 0.0 | HQ173338.1 Aquilegia formosa AGAMOUS-like E 24-like protein 1 (AGL24.1) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010277489.1 | 1e-104 | PREDICTED: MADS-box protein JOINTLESS-like isoform X2 | ||||
Swissprot | Q9FUY6 | 1e-93 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A1U8BK08 | 1e-102 | A0A1U8BK08_NELNU; MADS-box protein JOINTLESS-like isoform X2 | ||||
STRING | XP_010277487.1 | 1e-103 | (Nelumbo nucifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-95 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe5G160100.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|