PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe4G279900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 72aa MW: 8356.71 Da PI: 5.7063 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.2 | 2.2e-09 | 23 | 61 | 5 | 45 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 T++E++ll + k+ G++ W++Ia +++ gR ++++ +w Aqcoe4G279900.1.p 23 TEQEEDLLRRMYKLVGNR-WDLIAGRIP-GRKPEELERFWI 61 9*****************.*********.********9995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 5.1E-4 | 18 | 66 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.1E-8 | 22 | 61 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.295 | 23 | 60 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 4.9E-8 | 23 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.26E-6 | 23 | 60 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-10 | 23 | 61 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MGMIHICEVE EVSSIEWKSI SLTEQEEDLL RRMYKLVGNR WDLIAGRIPG RKPEELERFW 60 IMAHWGKGLA S* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018812764.1 | 1e-27 | PREDICTED: transcription factor TRY-like isoform X1 | ||||
Swissprot | Q8GV05 | 8e-26 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A2G5D490 | 7e-44 | A0A2G5D490_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_028_00182.1 | 1e-44 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 3e-28 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe4G279900.1.p |