PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aqcoe3G433800.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 155aa MW: 17504.2 Da PI: 9.4774 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80 | 1.6e-25 | 18 | 66 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 ++ie++s+r+vtfskRr+g++KKA+EL++LC+a++a+i+ s+++k+y++ Aqcoe3G433800.1.p 18 EKIESSSQRYVTFSKRRTGLFKKASELCILCGADIAIIVSSPSQKIYTF 66 57**********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.698 | 10 | 70 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.0E-30 | 10 | 69 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-28 | 11 | 100 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.32E-31 | 11 | 80 | No hit | No description |
PRINTS | PR00404 | 2.0E-18 | 12 | 32 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.2E-25 | 19 | 66 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-18 | 32 | 47 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-18 | 47 | 68 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MDLTRKKRGT GRKKVPIEKI ESSSQRYVTF SKRRTGLFKK ASELCILCGA DIAIIVSSPS 60 QKIYTFGHPS VDSVVDRFLN QDDHHMSALG HDQQQQQIQY IEILGQLEAE KKRGEIIEQL 120 KPSGWDAPID SLQLQELQQM KQALVELKKK VLGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-14 | 11 | 92 | 1 | 82 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026442040.1 | 7e-48 | agamous-like MADS-box protein AGL61 | ||||
Swissprot | Q4PSU4 | 5e-41 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
TrEMBL | A0A2G5F862 | 1e-108 | A0A2G5F862_AQUCA; Uncharacterized protein | ||||
STRING | Aquca_002_01450.1 | 1e-109 | (Aquilegia coerulea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24840.1 | 1e-34 | AGAMOUS-like 61 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aqcoe3G433800.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|