PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G368000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 291aa    MW: 33789.3 Da    PI: 5.0438
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G368000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK825.8e-26137186352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +++s +++s+yF++pi++AAkeL+v+lT LKr+CR+ GI+RWPhRk+ sl
  Aqcoe2G368000.1.p 137 SKLSRKTISSYFYMPITQAAKELNVGLTKLKRRCREVGIPRWPHRKLMSL 186
                        57999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7122207IPR003035RWP-RK domain
PfamPF020424.4E-22139186IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MENNYSSNNE IIPFEDDPFL LSNQLLPLDR LDFSDDYSSF NNCQWETSIG ESPLEPLPLV  60
ESFPIDLYSS YNFNIVPSQG DSYKMWENEF GVLLDDLEVN HKCEDDREIV LMFNNGQCVE  120
QVESNKCKKR KTTSSLSKLS RKTISSYFYM PITQAAKELN VGLTKLKRRC REVGIPRWPH  180
RKLMSLQTLI NNVQEMGAVG GEASDSRIRE VLDLLKQQKK LMEEIPEVEL EENTKRLRQA  240
YFKANYKRRK LGQMSDWELC PRSFESFEAF ETSTNCTSKL KDRNIRNVTI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258431.16e-62PREDICTED: protein RKD1-like
TrEMBLA0A1U8AA291e-60A0A1U8AA29_NELNU; protein RKD1-like
STRINGXP_010258431.12e-61(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-38RWP-RK domain-containing protein