PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco026269.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 50aa MW: 5383.98 Da PI: 7.5231 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 55.5 | 2.4e-17 | 1 | 32 | 135 | 166 |
YABBY 135 eeiqrikasnPdishreafsaaaknWahfPki 166 eeiqrik+++P i+h+ afs+aaknWahfP+i Aco026269.1 1 EEIQRIKTKDPTITHKAAFSTAAKNWAHFPRI 32 8*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 5.0E-16 | 1 | 33 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 50 aa Download sequence Send to blast |
EEIQRIKTKD PTITHKAAFS TAAKNWAHFP RIPAKGDGES CSVSGEEKD* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020099516.1 | 4e-28 | protein YABBY 7-like | ||||
TrEMBL | F1AM02 | 6e-15 | F1AM02_ANNCH; Transcription factor INO | ||||
STRING | XP_008812180.1 | 1e-14 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 6e-13 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco026269.1 |