PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family NAC
Protein Properties Length: 388aa    MW: 43326.9 Da    PI: 7.91
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55171441129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdee++++yL++kv + +++  +++ evd++k+ePwdLp+k+k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkdke+++ kg 
  Aco012600.1  17 LPPGFRFHPTDEEIITNYLTNKVVSPSFTS-RAMGEVDLNKCEPWDLPSKAKMGEKEWYFFCQRDRKYPTGLRTNRATEAGYWKATGKDKEIYRGKGV 113
                  79*************************999.88***************99999********************************************* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrapkgek++Wvmhe+rle
  Aco012600.1 114 LVGMKKTLVFYKGRAPKGEKSNWVMHEFRLE 144
                  ****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-6215169IPR003441NAC domain
PROSITE profilePS5100558.37817169IPR003441NAC domain
PfamPF023653.9E-2818143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MVEVPLVHQG EDYCMDLPPG FRFHPTDEEI ITNYLTNKVV SPSFTSRAMG EVDLNKCEPW  60
DLPSKAKMGE KEWYFFCQRD RKYPTGLRTN RATEAGYWKA TGKDKEIYRG KGVLVGMKKT  120
LVFYKGRAPK GEKSNWVMHE FRLEGKSIIF SDRKIVPKDE WVVCRVHHKG INGSKKNQIG  180
ELIRVNSSSQ EDLMDYLNFN SMNTPTSNFS ISTTTSTPTT TTTTTTTPPH FPPTMLGLED  240
PDPSTHKSSA LLIPYNNFNS YTNVQGKPPM TFPPPQDPSS LLLQGSPTMG YLHQEEAIMK  300
TLIGSKGNCK VEQLSNSDGT GFRIVDGDHS CAEYLSVMPK NSSSGSYGHQ PYNFGHHLNG  360
SSTGPLVADF DNQYWSHIGN HKGGLFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-521517515171NO APICAL MERISTEM PROTEIN
1ut4_B1e-521517515171NO APICAL MERISTEM PROTEIN
1ut7_A1e-521517515171NO APICAL MERISTEM PROTEIN
1ut7_B1e-521517515171NO APICAL MERISTEM PROTEIN
4dul_A1e-521517515171NAC domain-containing protein 19
4dul_B1e-521517515171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020101345.10.0NAC domain-containing protein 100-like
SwissprotQ9FK444e-88NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A199UHF20.0A0A199UHF2_ANACO; NAC domain-containing protein 100
STRINGXP_008787998.11e-123(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-90Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]