PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco008510.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 163aa MW: 18254.6 Da PI: 7.9779 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.8 | 4.5e-33 | 10 | 67 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s++prsYYrCt ++C vkk+vers+edp++v++tYeg+H h+ Aco008510.1 10 EDGYRWRKYGQKAVKNSPYPRSYYRCTNSKCAVKKRVERSSEDPSIVITTYEGQHCHH 67 8******************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.4E-32 | 2 | 68 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.44E-28 | 3 | 67 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.907 | 4 | 69 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.0E-38 | 9 | 68 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.8E-26 | 10 | 67 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MTKSEIDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTNSKC AVKKRVERSS EDPSIVITTY 60 EGQHCHHTVT FPRCTPGIVH NTHNSVLTEQ IAYPSQAQLY LPTSTLQLYQ NSNPPPPLSE 120 AGREMVGLLR EEVQSSPLER TAPIPVDEGL LGDMVPPGMR NG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 1 | 66 | 9 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 1 | 66 | 9 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00067 | PBM | Transfer from AT1G69310 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM661126 | 4e-87 | KM661126.1 Ananas bracteatus clone 42020 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020095930.1 | 1e-118 | probable WRKY transcription factor 57, partial | ||||
Swissprot | Q9C983 | 6e-50 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
TrEMBL | A0A199W414 | 1e-112 | A0A199W414_ANACO; Putative WRKY transcription factor 57 | ||||
STRING | XP_008776993.1 | 3e-63 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2125 | 37 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69310.2 | 2e-52 | WRKY DNA-binding protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco008510.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|