PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aco004632.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 227aa MW: 25590.1 Da PI: 10.2248 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 139.5 | 2e-43 | 19 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF+Ptdeelvv+yL++k+ + +l++ vi+e+d+ ++P+dLp + e e yfF+ r+ k+ g+r+ rat+sgyWkatgkd+++ls+ k+ Aco004632.1 19 LPPGFRFRPTDEELVVHYLRRKAFSCPLPA-AVINEIDLGMCDPRDLPGGI---EGERYFFALREAKNLGGNRSCRATSSGYWKATGKDTPILSSkKN 112 79***************************9.89***************554...4589***********************************98677 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 +lvg+k+tL+f++g+ p+ +tdW+mheyrl Aco004632.1 113 HLVGMKRTLTFHRGEPPRRARTDWIMHEYRL 143 78***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.98E-54 | 15 | 171 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.663 | 19 | 170 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.3E-25 | 20 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MEKSVPRSTE HGVGVLLRLP PGFRFRPTDE ELVVHYLRRK AFSCPLPAAV INEIDLGMCD 60 PRDLPGGIEG ERYFFALREA KNLGGNRSCR ATSSGYWKAT GKDTPILSSK KNHLVGMKRT 120 LTFHRGEPPR RARTDWIMHE YRLAVPAKNN AIHSCSAQQK EWVVCRIFKK NRAGKTSGDN 180 TRIWRGDVRF THHVTRREDR IRSSPPSPSS SSSCVTDLSD EEEISC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-40 | 17 | 175 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-40 | 17 | 175 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-40 | 17 | 175 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-40 | 17 | 175 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-40 | 17 | 175 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-40 | 17 | 175 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-40 | 17 | 175 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020088157.1 | 1e-168 | NAC domain-containing protein 83-like | ||||
Swissprot | Q9FY93 | 8e-61 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A199W9Y8 | 1e-152 | A0A199W9Y8_ANACO; NAC domain-containing protein 83 | ||||
STRING | XP_008777977.1 | 4e-74 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12805 | 27 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 3e-63 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Aco004632.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|