PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn293811 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 165aa MW: 19248.6 Da PI: 7.7417 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.2 | 4.2e-14 | 85 | 134 | 6 | 55 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + rr+++NRe+ArrsR RK++ ++eL v L +eN++L ++l++ ++ Achn293811 85 KRRRMISNRESARRSRMRKQKHLDELWSQVMWLRNENHQLLDKLNRASES 134 579**************************************999987765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.0E-13 | 80 | 144 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.461 | 82 | 145 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.0E-11 | 82 | 134 | No hit | No description |
SuperFamily | SSF57959 | 1.93E-12 | 85 | 133 | No hit | No description |
CDD | cd14702 | 2.74E-20 | 85 | 136 | No hit | No description |
Pfam | PF00170 | 6.0E-12 | 85 | 133 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 87 | 102 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MHHNEVISQL HCLLPPFPNP YHPHFSSPQN NTPSFQLTKS SNPLPYQLPI TPQVQEFSPQ 60 PTCLNSYSTS DEANEQQLSL INESKRRRMI SNRESARRSR MRKQKHLDEL WSQVMWLRNE 120 NHQLLDKLNR ASESHDRVVQ ENSQLKEEAS ELRLIITDMQ LNSP* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 96 | 103 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028073937.1 | 2e-75 | basic leucine zipper 43-like | ||||
Refseq | XP_028085357.1 | 2e-75 | basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 1e-37 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A2R6RYG7 | 1e-115 | A0A2R6RYG7_ACTCH; Basic leucine zipper like | ||||
STRING | POPTR_0004s10990.1 | 1e-69 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA947 | 24 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 5e-48 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|