PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn181301 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 143aa MW: 15887.4 Da PI: 7.5058 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.1 | 2.2e-42 | 58 | 134 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C++d++ ak yhrrhkvCe+h+k pvv+v+g++qrfCqqCsrfhelsefDe+krsCr+rLa+hnerrrk+++ Achn181301 58 CQVENCATDMTYAKPYHRRHKVCEFHAKVPVVAVAGIHQRFCQQCSRFHELSEFDESKRSCRTRLAGHNERRRKSSH 134 **************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 2.3E-57 | 1 | 142 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 1.5E-34 | 50 | 119 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.778 | 55 | 132 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.55E-39 | 56 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-32 | 58 | 131 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
METNKAGGKR RMKEEAGEDE EEEEEEDSVG LGSTEDDKKK KVSGRRGTSG GGSTQPSCQV 60 ENCATDMTYA KPYHRRHKVC EFHAKVPVVA VAGIHQRFCQ QCSRFHELSE FDESKRSCRT 120 RLAGHNERRR KSSHDITGEG SG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 7e-36 | 49 | 131 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028074804.1 | 2e-58 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q38741 | 1e-55 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A2R6RAP8 | 5e-97 | A0A2R6RAP8_ACTCH; Squamosa promoter-binding-like protein | ||||
STRING | cassava4.1_018710m | 4e-52 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 3e-42 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|