PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Achn167511 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 68aa MW: 7461.64 Da PI: 8.0478 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.5 | 3.1e-08 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 rg+WT+ Ed+ l++++k +G g W+ ++ Achn167511 14 RGAWTAVEDKVLIEYIKVHGEGKWRNLPKL 43 89**********************988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-11 | 5 | 48 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.1E-8 | 8 | 48 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.992 | 9 | 49 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 4.8E-6 | 14 | 43 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.20E-5 | 16 | 49 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRSRCCPKE GLNRGAWTAV EDKVLIEYIK VHGEGKWRNL PKLAVCYRTL QVEGDGGQLM 60 EVATDAI* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:22575450, ECO:0000269|PubMed:25060192}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269|PubMed:19211694, ECO:0000269|PubMed:25060192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010107990.1 | 4e-22 | myb-related protein Zm38 | ||||
Swissprot | Q9M0J5 | 2e-14 | MYB41_ARATH; Transcription factor MYB41 | ||||
TrEMBL | W9S6E4 | 1e-20 | W9S6E4_9ROSA; Anthocyanin regulatory C1 protein | ||||
STRING | XP_010107990.1 | 2e-21 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA15484 | 7 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28110.1 | 9e-17 | myb domain protein 41 |
Publications ? help Back to Top | |||
---|---|---|---|
|