PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA53G01333 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 145aa MW: 16112.1 Da PI: 9.6711 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.7 | 4.8e-33 | 63 | 121 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+ AA53G01333 63 LDDGYRWRKYGQKSVKNNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGVHNHP 121 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-33 | 50 | 121 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.67E-29 | 55 | 122 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.241 | 58 | 123 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.0E-38 | 63 | 122 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-26 | 64 | 121 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MAAPPPPLAF SGDIVAPSSS SCGGEAVLDH ISNNNNNKGK GKRSGAGATQ RIAFHTRSDD 60 DVLDDGYRWR KYGQKSVKNN AHPRSYYRCT YHTCNVKKQV QRLAKDPNVV VTTYEGVHNH 120 PCEKLMETLS PLLRQLQFLT RVSDL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 7e-27 | 47 | 120 | 1 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 7e-27 | 47 | 120 | 1 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA53G01333 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM593163 | 6e-92 | KM593163.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY115) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009112792.1 | 1e-74 | PREDICTED: probable WRKY transcription factor 56 | ||||
Swissprot | Q8VWQ4 | 5e-74 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A1J3I9Q0 | 5e-77 | A0A1J3I9Q0_NOCCA; Putative WRKY transcription factor 56 | ||||
STRING | Bra027768.1-P | 4e-74 | (Brassica rapa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 5e-72 | WRKY DNA-binding protein 56 |