PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA32G01196 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 174aa MW: 19906.3 Da PI: 9.3844 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.3 | 5.8e-32 | 95 | 153 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r ed+ vv++tYeg H+h+ AA32G01196 95 LDDGYRWRKYGQKAVKNNRFPRSYYKCTQEGCKVKKQVQRLGEDEGVVVTTYEGVHTHP 153 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.9E-34 | 80 | 154 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.84E-29 | 87 | 154 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.62 | 90 | 155 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.1E-37 | 95 | 154 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.7E-26 | 96 | 153 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006817 | Biological Process | phosphate ion transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MENRCQVLFP CSSSSSSANH QLTGGEGVLG LKINVDYAGE DKSGVHNYTH SAPQTTTSSL 60 LHTTHHNEER QKCNKKKKQK EPRFAFQTRS QVDILDDGYR WRKYGQKAVK NNRFPRSYYK 120 CTQEGCKVKK QVQRLGEDEG VVVTTYEGVH THPVEKPSDN FQQILTQMQI FPPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 85 | 152 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 85 | 152 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00325 | DAP | Transfer from AT3G01970 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA32G01196 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006300107.1 | 1e-67 | probable WRKY transcription factor 45 | ||||
Swissprot | Q9S763 | 7e-57 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A087H6A0 | 3e-70 | A0A087H6A0_ARAAL; Uncharacterized protein | ||||
STRING | Bostr.1460s0015.1.p | 3e-72 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 2e-56 | WRKY DNA-binding protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|