PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AA26G00226

Organism

Aethionema arabicum

Taxonomic ID

228871

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema

Family

NAC

Protein Properties

Length: 324aa MW: 35610.2 Da PI: 7.987

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AA26G00226	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	174.4	3.4e-54	30	157	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 +ppGfrFhPtdeel+++yL kkv ++++++ +i++vd++k+ePw+Lp+k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkd+e++s+ +++ AA26G00226 30 MPPGFRFHPTDEELITYYLLKKVLDSNFSC-AAISQVDLNKSEPWELPEKAKLGEKEWYFFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSkTSS 127 79**************************.88***********99999************************************985677 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 l g+kktLvfykgrapkgek+ Wvmheyrl AA26G00226 128 LLGMKKTLVFYKGRAPKGEKSCWVMHEYRL 157 8*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	7.59E-62	28	182	IPR003441	NAC domain
PROSITE profile	PS51005	58.738	30	182	IPR003441	NAC domain
Pfam	PF02365	1.5E-28	31	157	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009793	Biological Process	embryo development ending in seed dormancy
GO:0010014	Biological Process	meristem initiation
GO:0010160	Biological Process	formation of organ boundary
GO:0010223	Biological Process	secondary shoot formation
GO:0048467	Biological Process	gynoecium development
GO:0051782	Biological Process	negative regulation of cell division
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 324 aa Download sequence Send to blast
MDIDIFNSRW DLNMRSRSLQ ENEEDSRTLM PPGFRFHPTD EELITYYLLK KVLDSNFSCA 60 AISQVDLNKS EPWELPEKAK LGEKEWYFFT LRDRKYPTGL RTNRATEAGY WKATGKDREI 120 KSSKTSSLLG MKKTLVFYKG RAPKGEKSCW VMHEYRLDGK FSYHYISSSA KDEWVLCKVC 180 LKNGVSKEMK LISNSSSVAG EFSSGGFTSA GSLVPPAIGG LSSGVSATTE HVSCFSNTVT 240 ADSSFSSFLP PLTPLAPRQH RYGSDDVAAG SFNDFGGSCI DPVCFPNLPS LPPTLLQPSP 300 HTFAMYGGSG GGCGGSAVSW PFAI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-51	19	188	6	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-51	19	188	6	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-51	19	188	6	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-51	19	188	6	171	NO APICAL MERISTEM PROTEIN
3swm_A	1e-51	19	188	9	174	NAC domain-containing protein 19
3swm_B	1e-51	19	188	9	174	NAC domain-containing protein 19
3swm_C	1e-51	19	188	9	174	NAC domain-containing protein 19
3swm_D	1e-51	19	188	9	174	NAC domain-containing protein 19
3swp_A	1e-51	19	188	9	174	NAC domain-containing protein 19
3swp_B	1e-51	19	188	9	174	NAC domain-containing protein 19
3swp_C	1e-51	19	188	9	174	NAC domain-containing protein 19
3swp_D	1e-51	19	188	9	174	NAC domain-containing protein 19
4dul_A	1e-51	19	188	6	171	NAC domain-containing protein 19
4dul_B	1e-51	19	188	6	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:11245578, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:12787253, ECO:0000269\|PubMed:14617069, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00357	DAP	Transfer from AT3G15170	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AA26G00226

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17056621, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ435161	1e-174	FJ435161.1 Cardamine hirsuta CUP-SHAPED COTYLEDON1 (CUC1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010502576.1	1e-144	PREDICTED: protein CUP-SHAPED COTYLEDON 1
Swissprot	Q9FRV4	1e-129	NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBL	V4M7W3	1e-142	V4M7W3_EUTSA; Uncharacterized protein
STRING	XP_010502576.1	1e-144	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13481	15	28

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15170.1	1e-127	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Shinohara N,Ohbayashi I,Sugiyama M Involvement of rRNA biosynthesis in the regulation of CUC1 gene expression and pre-meristematic cell mound formation during shoot regeneration. Front Plant Sci, 2014. 5: p. 159 [PMID:24808900] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292]